PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp4g19580
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassicaceae incertae sedis; Schrenkiella
Family WRKY
Protein Properties Length: 416aa    MW: 45715.7 Da    PI: 9.5983
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp4g19580genomethellungiellaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY100.31.2e-31162218360
                -SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
       WRKY   3 DgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                DgynWrKYGqK+vkgs++prsYY+Ct+++Cpvkkkvers  +++v ei+Y+geHnh+k
  Tp4g19580 162 DGYNWRKYGQKQVKGSDCPRSYYKCTHPKCPVKKKVERSM-EGQVSEIVYQGEHNHSK 218
                9***************************************.***************85 PP

2WRKY50.34.6e-163553932159
                -EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
       WRKY  21 prsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                 +sYYrCtsa+C+++k+ver+++dp+++++tYeg+Hnh+
  Tp4g19580 355 RKSYYRCTSANCRARKHVERASDDPRAFITTYEGKHNHH 393
                579***********************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.805.6E-28153219IPR003657WRKY domain
SMARTSM007741.9E-32160218IPR003657WRKY domain
SuperFamilySSF1182902.09E-24161219IPR003657WRKY domain
PfamPF031061.0E-24162216IPR003657WRKY domain
PROSITE profilePS5081122.63162219IPR003657WRKY domain
Gene3DG3DSA:2.20.25.804.9E-16338393IPR003657WRKY domain
PROSITE profilePS5081119.6343395IPR003657WRKY domain
SuperFamilySSF1182907.45E-17343393IPR003657WRKY domain
SMARTSM007742.8E-20348394IPR003657WRKY domain
PfamPF031069.8E-12355393IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009957Biological Processepidermal cell fate specification
GO:0010214Biological Processseed coat development
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 416 aa     Download sequence    Send to blast
MEVKESERVV IAKPVASRPS CFSIRTFTEL LTDSVTVSPQ SNCRETVDVA IRPKTLRFKQ  60
PAAASVSCPR VEGNGKVKSG DDSESRNYVI YKPKAKLVSK ATVSVLANML QGDRQQTWRQ  120
TEAVAYGKSL SQGANRAGPH LVPRVPSFTE SETSIADRSS VDGYNWRKYG QKQVKGSDCP  180
RSYYKCTHPK CPVKKKVERS MEGQVSEIVY QGEHNHSKPS CPLPRRASSS SSSGIQKPSK  240
GLVSEGSTGQ DPNNVYYHPL WSNQSNESSK SRTEKMNEGC VTTPFEFAVP RSANSTGGTS  300
DSGCRSSQCD EGSIGGELDD PSKSKRRKNE KQSSEAGVSQ SSVESDSLED GFRWRKSYYR  360
CTSANCRARK HVERASDDPR AFITTYEGKH NHHLLLGPPT SSTLPFSSPQ HSNQAV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A1e-17149394378Probable WRKY transcription factor 4
2lex_A1e-17149394378Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB2896070.0AB289607.1 Arabidopsis thaliana TTG2 mRNA for WRKY transcription factor, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006410906.10.0hypothetical protein EUTSA_v10016692mg
SwissprotQ9ZUU00.0WRK44_ARATH; WRKY transcription factor 44
TrEMBLV4M7R80.0V4M7R8_EUTSA; Uncharacterized protein
STRINGAT2G37260.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM83622740
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37260.10.0WRKY family protein